General Information

  • ID:  hor005371
  • Uniprot ID:  P01349
  • Protein name:  Relaxin B chain
  • Gene name:  NA
  • Organism:  Carcharias taurus (Sand tiger shark) (Eugomphodus taurus)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcharias (genus), Odontaspididae (family), Lamniformes (order), Galeoidea (superorder), Galeomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLCGRGFIRAIIFACGGSRW
  • Length:  20(1-20)
  • Propeptide:  QLCGRGFIRAIIFACGGSRWATSPAMSIKCCIYGCTKKDISVLC
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01349-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005371_AF2.pdbhor005371_ESM.pdb

Physical Information

Mass: 255073 Formula: C99H155N31O23S2
Absent amino acids: DEHKMNPTVY Common amino acids: G
pI: 10.52 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 9
Hydrophobicity: 56 Boman Index: -1579
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 88
Instability Index: 7166.5 Extinction Coefficient cystines: 5625
Absorbance 280nm: 296.05

Literature

  • PubMed ID:  7274472
  • Title:  On the primary and tertiary structure of relaxin from the sand tiger shark (Odontaspis taurus).
  • PubMed ID:  3780747
  • Title:   Isolation, purification, and the sequence of relaxin from spiny dogfish (Squalus acanthias).